Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF586 Rabbit Polyclonal Antibody (Biotin)

ZNF586 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9NXT0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ZNF586

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SSSLLQHQRVHTRERPYECSECGKSFSLRSNLIHHQRVHTGERHECGQCG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pira7 Protein Vector (Mouse) (pPM-C-His)
PV216393 500 ng

Pira7 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
DCPS Protein Lysate (Human) with C-Ha Tag
17743031 100 µg

DCPS Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Lentiviral human ZFP91 sgRNA gene knockout kit - Lentiviral human ZFP91 sgRNA gene knockout kit (25)
GTR15356265 1 Vial

Lentiviral human ZFP91 sgRNA gene knockout kit - Lentiviral human ZFP91 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Rat Ager/Advanced glycosylation end product-specific receptor ELISA Kit
orb1661535 96 Tests

Rat Ager/Advanced glycosylation end product-specific receptor ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal ASUN Antibody
NBP2-84473-0.1mL 0.1 mL

Rabbit Polyclonal ASUN Antibody

Sign In for Pricing
View Details
SORBS2 Rabbit Polyclonal Antibody (Cy3)
orb991133 100 µL

SORBS2 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details