Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF586 Rabbit Polyclonal Antibody (HRP)

ZNF586 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9NXT0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ZNF586

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSSLLQHQRVHTRERPYECSECGKSFSLRSNLIHHQRVHTGERHECGQCG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kappa Light Chain (HCAK1, Ig Kappa Chain C Region, IGKC, Immunoglobulin KM) (BSA & Azide Free) (MaxLight 550)
168816-AF-ML550 100 µL

Kappa Light Chain (HCAK1, Ig Kappa Chain C Region, IGKC, Immunoglobulin KM) (BSA & Azide Free) (MaxLight 550)

Sign In for Pricing
View Details
AGRP amide, aa82-131, Mouse
301870 100 µg

AGRP amide, aa82-131, Mouse

Sign In for Pricing
View Details
EVA1 Rabbit Polyclonal Antibody (BF555)
orb2547848 100 µL

EVA1 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Gpr45 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3448406 1.0 µg DNA

Gpr45 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Mouse Monoclonal Prohibitin Antibody (PHB/3194) [DyLight 550]
NBP3-08752R 100 µL

Mouse Monoclonal Prohibitin Antibody (PHB/3194) [DyLight 550]

Sign In for Pricing
View Details
RGS4 Blocking Peptide
CBP3005-01 1 mg

RGS4 Blocking Peptide

Sign In for Pricing
View Details