Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF8 Rabbit Polyclonal Antibody (FITC)

ZNF8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HF.18, Zfp128

UniProt

P17098

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AVDFTQEEWGQLDPTQRILYRDVMLETFGHLLSIGPELPKPEVISQLEQG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_066575

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transducin alpha Rabbit Polyclonal Antibody (BF647)
orb2498690 100 µL

Transducin alpha Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Tmem129 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3496904 1.0 µg DNA

Tmem129 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
CXCR5 (C-X-C Chemokine Receptor Type 5, CXC-R5, CXCR-5, Burkitt Lymphoma Receptor 1, Monocyte-derived Receptor 15, MDR-15, CD185, BLR1, MDR15) (Biotin)
MBS6141426-01 0.1 mL

CXCR5 (C-X-C Chemokine Receptor Type 5, CXC-R5, CXCR-5, Burkitt Lymphoma Receptor 1, Monocyte-derived Receptor 15, MDR-15, CD185, BLR1, MDR15) (Biotin)

Sign In for Pricing
View Details
CXCR5 (C-X-C Chemokine Receptor Type 5, CXC-R5, CXCR-5, Burkitt Lymphoma Receptor 1, Monocyte-derived Receptor 15, MDR-15, CD185, BLR1, MDR15) (Biotin)
MBS6141426-02 5x 0.1 mL

CXCR5 (C-X-C Chemokine Receptor Type 5, CXC-R5, CXCR-5, Burkitt Lymphoma Receptor 1, Monocyte-derived Receptor 15, MDR-15, CD185, BLR1, MDR15) (Biotin)

Sign In for Pricing
View Details
DCAF17 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
17704066 1.0 µg DNA

DCAF17 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse Primary Cardiac Fibroblasts
T4591 5x105 cells / 1 mL

Mouse Primary Cardiac Fibroblasts

Sign In for Pricing
View Details