Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF140 Rabbit Polyclonal Antibody (FITC)

ZNF140 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PHZ-39

UniProt

P52738

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF140

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HTGEKPYVCKVCNKSFSWSSNLAKHQRTHTLDNPYEYENSFNYHSFLTEH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_003431

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-INSL4 Antibody
DL98693A-01 50 µL

Rabbit anti-INSL4 Antibody

Sign In for Pricing
View Details
Rabbit anti-INSL4 Antibody
DL98693A-02 100 µL

Rabbit anti-INSL4 Antibody

Sign In for Pricing
View Details
MOCS2 (Molybdopterin Synthase Sulfur Carrier Subunit, MOCO1-A, Molybdenum Cofactor Synthesis Protein 2 Small Subunit, MOCS2, MOCO1)
406726-01 50 µL

MOCS2 (Molybdopterin Synthase Sulfur Carrier Subunit, MOCO1-A, Molybdenum Cofactor Synthesis Protein 2 Small Subunit, MOCS2, MOCO1)

Sign In for Pricing
View Details
MOCS2 (Molybdopterin Synthase Sulfur Carrier Subunit, MOCO1-A, Molybdenum Cofactor Synthesis Protein 2 Small Subunit, MOCS2, MOCO1)
406726-02 100 µL

MOCS2 (Molybdopterin Synthase Sulfur Carrier Subunit, MOCO1-A, Molybdenum Cofactor Synthesis Protein 2 Small Subunit, MOCS2, MOCO1)

Sign In for Pricing
View Details
Lentiviral mouse Aqp11 shRNA (UAS) - Lentiviral mouse Aqp11 shRNA (UAS) (100)
GTR15298029 1 Vial

Lentiviral mouse Aqp11 shRNA (UAS) - Lentiviral mouse Aqp11 shRNA (UAS) (100)

Sign In for Pricing
View Details
Rabbit Anti-Pig IgG (H&L) - Alexa Fluor 660
YLF0436-01 100 µL

Rabbit Anti-Pig IgG (H&L) - Alexa Fluor 660

Sign In for Pricing
View Details