Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF177 Rabbit Polyclonal Antibody (HRP)

ZNF177 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PIGX

UniProt

Q13360

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF177

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AFRNSSCLRVHVRTHTGEKPYKCFQCEKAFSTSTNLIMHKRIHNGQKLHE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_003442

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eukaryotic Translation Initiation Factor 3K Human Recombinant
rAP-3249 1 Each

Eukaryotic Translation Initiation Factor 3K Human Recombinant

Sign In for Pricing
View Details
DNAAF9 Knockout Hela Polyclonal Cells
ARG39039 1 Million

DNAAF9 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
C1orf55 (SDE2) Human shRNA Plasmid Kit (Locus ID 163859)
TL306004 1 Kit

C1orf55 (SDE2) Human shRNA Plasmid Kit (Locus ID 163859)

Sign In for Pricing
View Details
CAMK2A (Calcium/Calmodulin-dependent Protein Kinase Type II Subunit alpha, CaM Kinase II Subunit alpha, CaMK-II Subunit alpha, CAMKA, KIAA0968) discontinued
C1035-25B9 100 µg

CAMK2A (Calcium/Calmodulin-dependent Protein Kinase Type II Subunit alpha, CaM Kinase II Subunit alpha, CaMK-II Subunit alpha, CAMKA, KIAA0968) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Zpbp2 shRNA (UAS) - Lentiviral mouse Zpbp2 shRNA (UAS) (25)
GTR15221933 1 Vial

Lentiviral mouse Zpbp2 shRNA (UAS) - Lentiviral mouse Zpbp2 shRNA (UAS) (25)

Sign In for Pricing
View Details
FFAR1 Rabbit Polyclonal Antibody (HRP)
orb2081228 100 µL

FFAR1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details