Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF205 Rabbit Polyclonal Antibody (Biotin)

ZNF205 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RhitH, Zfp13, ZNF210

UniProt

O95201

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF205

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PYACPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGAAAAGALATPPPA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_003447

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Verzistobart Biosimilar (Monoclonal, IgG1)
A138249 100 µL

Verzistobart Biosimilar (Monoclonal, IgG1)

Sign In for Pricing
View Details
Sodium Carbonate saturated Solution
02379 00500 500 mL

Sodium Carbonate saturated Solution

Sign In for Pricing
View Details
GITR-L Antibody (YA1515, Rabbit)
HY-P81770 1 Each

GITR-L Antibody (YA1515, Rabbit)

Sign In for Pricing
View Details
TP53INP2 3'UTR GFP Stable Cell Line
TU076136 1.0 mL

TP53INP2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
LMO7 (LIM Domain Only Protein 7, LMO-7, F-box Only Protein 20, LOMP, FBX20, FBXO20, KIAA0858) (APC)
129144-APC 100 µL

LMO7 (LIM Domain Only Protein 7, LMO-7, F-box Only Protein 20, LOMP, FBX20, FBXO20, KIAA0858) (APC)

Sign In for Pricing
View Details
IL11ra1, Recombinant, Rat, aa24-371, His-Tag (Interleukin-11 Receptor Subunit alpha)
369076 10 µg

IL11ra1, Recombinant, Rat, aa24-371, His-Tag (Interleukin-11 Receptor Subunit alpha)

Sign In for Pricing
View Details