Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eed Rabbit Polyclonal Antibody (FITC)

Eed Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Afx, Afxh, Mllt7

UniProt

Q9WVH3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRL

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_061259

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Haier 2-6C Blood Bank Upright Refrigerator LED Display 629L
REF2318 1 Each

Haier 2-6C Blood Bank Upright Refrigerator LED Display 629L

Sign In for Pricing
View Details
OR2K2 (Olfactory Receptor 2K2, Olfactory Receptor, Family 2, Subfamily K, Member 2)
487650 100 µL

OR2K2 (Olfactory Receptor 2K2, Olfactory Receptor, Family 2, Subfamily K, Member 2)

Sign In for Pricing
View Details
Mouse Transthyretin (TTR) ELISA Kit
YP-W21426-01 48 Tests

Mouse Transthyretin (TTR) ELISA Kit

Sign In for Pricing
View Details
Mouse Transthyretin (TTR) ELISA Kit
YP-W21426-02 96 Tests

Mouse Transthyretin (TTR) ELISA Kit

Sign In for Pricing
View Details
Stabilin-2 (FEEL-2, Fasciclin, EGF-like, Laminin Type EGF-like, Link Domain Containing Scavenger Receptor 2, FELE-2, FELL-2, FEX2, HARE, hyaluronan receptor for endocytosis, STAB2)
145617 100 µg

Stabilin-2 (FEEL-2, Fasciclin, EGF-like, Laminin Type EGF-like, Link Domain Containing Scavenger Receptor 2, FELE-2, FELL-2, FEX2, HARE, hyaluronan receptor for endocytosis, STAB2)

Sign In for Pricing
View Details
Ubd 3'UTR GFP Stable Cell Line
TU171446 1.0 mL

Ubd 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details