Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eed Rabbit Polyclonal Antibody (HRP)

Eed Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Afx, Afxh, Mllt7

UniProt

Q9WVH3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRL

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_061259

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIPK2 Antibody FITC
MBS5400421-01 0.1 mg

HIPK2 Antibody FITC

Sign In for Pricing
View Details
HIPK2 Antibody FITC
MBS5400421-02 5x 0.1 mg

HIPK2 Antibody FITC

Sign In for Pricing
View Details
Dnaic1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
18363064 1.0 µg DNA

Dnaic1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Deinococcus radiodurans Arginine--tRNA ligase (argS), partial
MBS1431071 Inquire

Recombinant Deinococcus radiodurans Arginine--tRNA ligase (argS), partial

Sign In for Pricing
View Details
Mouse Monoclonal FXR2 Antibody (1G2) [Alexa Fluor 350]
NB300-259AF350 0.1 mL

Mouse Monoclonal FXR2 Antibody (1G2) [Alexa Fluor 350]

Sign In for Pricing
View Details
Dedicator of Cytokinesis protein 3 (DOCK3) Human ELISA Kit
C8351 96 Tests

Dedicator of Cytokinesis protein 3 (DOCK3) Human ELISA Kit

Sign In for Pricing
View Details