Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nr5a2 Rabbit Polyclonal Antibody (FITC)

Nr5a2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ftf, Lrh-1

UniProt

Q9QWM1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Nr5a2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QTEKFGQLLLRLPEIRAISKQAEDYLYYKHVNGDVPYNNLLIEMLHAKRA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_068510

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histidase (HAL) Human siRNA Oligo Duplex (Locus ID 3034)
SR302059 1 Kit

Histidase (HAL) Human siRNA Oligo Duplex (Locus ID 3034)

Sign In for Pricing
View Details
Lentiviral human PBOV1 sgRNA gene knockout kit - Lentiviral human PBOV1 sgRNA gene knockout kit (plasmid)
GTR15396335 1 Vial

Lentiviral human PBOV1 sgRNA gene knockout kit - Lentiviral human PBOV1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
HSD17B8 Protein Vector (Human) (pPM-C-HA)
PV020395 500 ng

HSD17B8 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
SWAP70 Antibody
AM2029b 400 µL

SWAP70 Antibody

Sign In for Pricing
View Details
Human CACNA1G activation kit by CRISPRa
GA105941 1 Kit

Human CACNA1G activation kit by CRISPRa

Sign In for Pricing
View Details
PARP1-IN-5 dihydrochloride
T9610-01 1 mg

PARP1-IN-5 dihydrochloride

Sign In for Pricing
View Details