Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Creg1 Rabbit Polyclonal Antibody (HRP)

Creg1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cre, Creg, AA755314

UniProt

O88668

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MMSGTVTKVNKTEEDYARDSLFVRHPEMKHWPSSHNWFFAKLKISRIWVL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035934

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Carbohyde sulfotransferase 11 (CHST11) ELISA Kit
GTR10318550 96 Well

Canine Carbohyde sulfotransferase 11 (CHST11) ELISA Kit

Sign In for Pricing
View Details
High density lipoprotein cholesterol Assay Kit
BC085 80 mL

High density lipoprotein cholesterol Assay Kit

Sign In for Pricing
View Details
Human Tyrosine-protein kinase JAK2 ELISA Kit
EK4910 Inquire

Human Tyrosine-protein kinase JAK2 ELISA Kit

Sign In for Pricing
View Details
Mouse Inhibin Beta B (INHbB) ELISA Kit
DLR-INHbB-Mu-48T 48 Tests

Mouse Inhibin Beta B (INHbB) ELISA Kit

Sign In for Pricing
View Details
PTH1R Rabbit Polyclonal Antibody
E53P03210 100 µL

PTH1R Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NAT16 (N-Term) Antibody
orb2630604 100 µL

NAT16 (N-Term) Antibody

Sign In for Pricing
View Details