Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BUD31 Rabbit Polyclonal Antibody (FITC)

BUD31 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

G10, EDG2, Cwc14, EDG-2, fSAP17, YCR063W

UniProt

P41223

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BUD31

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003901

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CARD4/NOD1 Rabbit Polyclonal Antibody (Carrier-free)
orb3078080 100 µg

CARD4/NOD1 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
GPR4 Protein Vector (Rat) (pPB-N-His)
PV271247 500 ng

GPR4 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
PDXK (Pyridoxal Kinase, Pyridoxine Kinase, C21orf97, C21orf124, DKFZp566A071, FLJ31940, FLJ37311, MGC15873, MGC31754, MGC52346, PKH, PNK, PRED79) (FITC)
MBS6388979-01 0.1 mL

PDXK (Pyridoxal Kinase, Pyridoxine Kinase, C21orf97, C21orf124, DKFZp566A071, FLJ31940, FLJ37311, MGC15873, MGC31754, MGC52346, PKH, PNK, PRED79) (FITC)

Sign In for Pricing
View Details
PDXK (Pyridoxal Kinase, Pyridoxine Kinase, C21orf97, C21orf124, DKFZp566A071, FLJ31940, FLJ37311, MGC15873, MGC31754, MGC52346, PKH, PNK, PRED79) (FITC)
MBS6388979-02 5x 0.1 mL

PDXK (Pyridoxal Kinase, Pyridoxine Kinase, C21orf97, C21orf124, DKFZp566A071, FLJ31940, FLJ37311, MGC15873, MGC31754, MGC52346, PKH, PNK, PRED79) (FITC)

Sign In for Pricing
View Details
PDCL3 (Phosducin-like 3, HTPHLP, MGC3062, PHLP3, VIAF, VIAF1) (FITC)
249909-FITC 100 µL

PDCL3 (Phosducin-like 3, HTPHLP, MGC3062, PHLP3, VIAF, VIAF1) (FITC)

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein 692 (ZNF692)
MBS1354831-01 0.02 mg (E-Coli)

Recombinant Human Zinc finger protein 692 (ZNF692)

Sign In for Pricing
View Details