Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BUD31 Rabbit Polyclonal Antibody (FITC)

BUD31 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

G10, EDG2, Cwc14, EDG-2, fSAP17, YCR063W

UniProt

P41223

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BUD31

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICR

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003901

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Microfibrillar Associated Protein 2 (MFAP2)
TRV-0050884-01 20 µL

Polyclonal Antibody to Microfibrillar Associated Protein 2 (MFAP2)

Sign In for Pricing
View Details
Polyclonal Antibody to Microfibrillar Associated Protein 2 (MFAP2)
TRV-0050884-02 100 µL

Polyclonal Antibody to Microfibrillar Associated Protein 2 (MFAP2)

Sign In for Pricing
View Details
Polyclonal Antibody to Microfibrillar Associated Protein 2 (MFAP2)
TRV-0050884-03 200 µL

Polyclonal Antibody to Microfibrillar Associated Protein 2 (MFAP2)

Sign In for Pricing
View Details
Polyclonal Antibody to Microfibrillar Associated Protein 2 (MFAP2)
TRV-0050884-04 1 mL

Polyclonal Antibody to Microfibrillar Associated Protein 2 (MFAP2)

Sign In for Pricing
View Details
Fatty Acid-Binding Protein, Heart (Fatty Acid-Binding Protein 3, Heart-Type Fatty Acid-Binding Protein, H-FABP, Mammary-Derived Growth Inhibitor, MDGI, Muscle Fatty Acid-Binding Protein, M-FABP, FABP3, FABP11, MDGI) (HRP)
227653 100 µg

Fatty Acid-Binding Protein, Heart (Fatty Acid-Binding Protein 3, Heart-Type Fatty Acid-Binding Protein, H-FABP, Mammary-Derived Growth Inhibitor, MDGI, Muscle Fatty Acid-Binding Protein, M-FABP, FABP3, FABP11, MDGI) (HRP)

Sign In for Pricing
View Details
Vom2r69 Protein Vector (Rat) (pPM-C-HA)
PV315908 500 ng

Vom2r69 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details