Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BUD31 Rabbit Polyclonal Antibody (HRP)

BUD31 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

G10, EDG2, Cwc14, EDG-2, fSAP17, YCR063W

UniProt

P41223

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BUD31

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICR

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003901

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aldh1L1 control peptide
278-0P 100 µg

Aldh1L1 control peptide

Sign In for Pricing
View Details
Pkhd1l1 siRNA Oligos set (Rat)
36878176 3x 5 nmol

Pkhd1l1 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Hsa-miR-635 miRNA Inhibitor
CIH0411-01 10 nmol

Hsa-miR-635 miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-635 miRNA Inhibitor
CIH0411-02 20 nmol

Hsa-miR-635 miRNA Inhibitor

Sign In for Pricing
View Details
Anti-Human IgG:HRP Conjugate
F163 12 mL

Anti-Human IgG:HRP Conjugate

Sign In for Pricing
View Details
ZC3H14 AAV siRNA Pooled Vector
50742161 1.0 µg

ZC3H14 AAV siRNA Pooled Vector

Sign In for Pricing
View Details