Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phox2b Rabbit Polyclonal Antibody (Biotin)

Phox2b Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NBPhox

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Phox2b

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTT

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_001077800

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAMBP, CT (STAMBP, AMSH, STAM-binding protein, Associated molecule with the SH3 domain of STAM, Endosome-associated ubiquitin isopeptidase) (Azide free) (HRP) discontinued
042367-HRP 200 µL

STAMBP, CT (STAMBP, AMSH, STAM-binding protein, Associated molecule with the SH3 domain of STAM, Endosome-associated ubiquitin isopeptidase) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Single Beam UV Visible Spectrophotometer BSSUV-102
BSSUV-102 Each

Single Beam UV Visible Spectrophotometer BSSUV-102

Sign In for Pricing
View Details
Mouse Thyroxine (T4) ELISA Kit
MBS9716929-01 48 Tests

Mouse Thyroxine (T4) ELISA Kit

Sign In for Pricing
View Details
Mouse Thyroxine (T4) ELISA Kit
MBS9716929-02 96 Tests

Mouse Thyroxine (T4) ELISA Kit

Sign In for Pricing
View Details
Mouse Thyroxine (T4) ELISA Kit
MBS9716929-03 5x 96 Tests

Mouse Thyroxine (T4) ELISA Kit

Sign In for Pricing
View Details
SBK3 siRNA (Human)
orb1849455-01 15 nmol

SBK3 siRNA (Human)

Sign In for Pricing
View Details