Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phox2b Rabbit Polyclonal Antibody (HRP)

Phox2b Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NBPhox

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Phox2b

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTT

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_001077800

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CYP89A2 Polyclonal Antibody
MBS7194168 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CYP89A2 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse anti Human Osteopontin:Biotin
MBS226220-01 0.1 mg

Mouse anti Human Osteopontin:Biotin

Sign In for Pricing
View Details
Mouse anti Human Osteopontin:Biotin
MBS226220-02 5x 0.1 mg

Mouse anti Human Osteopontin:Biotin

Sign In for Pricing
View Details
Bispyribac Sodium-d12
TRC-B525401-100MG 100 mg

Bispyribac Sodium-d12

Sign In for Pricing
View Details
Aconitate Hydratase, Mitochondrial (ACO2) Peptide
abx616169 100 µg

Aconitate Hydratase, Mitochondrial (ACO2) Peptide

Sign In for Pricing
View Details
KRT4 CRISPRa sgRNA lentivector (set of three targets)(Human)
26028121 3x 1.0µg DNA

KRT4 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details