Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phox2b Rabbit Polyclonal Antibody (HRP)

Phox2b Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NBPhox

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Phox2b

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTT

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_001077800

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhox4c Protein Vector (Mouse) (pPM-C-His)
PV224173 500 ng

Rhox4c Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
WNK4 Antibody (Biotin)
orb45345-01 50 µg

WNK4 Antibody (Biotin)

Sign In for Pricing
View Details
WNK4 Antibody (Biotin)
orb45345-02 100 µg

WNK4 Antibody (Biotin)

Sign In for Pricing
View Details
SLC25A4 AAV Vector (Mouse) (CMV)
44029104 1 µg

SLC25A4 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Mouse Vamp8 Pre-designed siRNA Set A
SI115830A 1 Each

Mouse Vamp8 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Human SNAI1 Protein, N-His
bs-100280P-01 20 µg

Recombinant Human SNAI1 Protein, N-His

Sign In for Pricing
View Details