Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF284 Rabbit Polyclonal Antibody (HRP)

ZNF284 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF284L

UniProt

Q2VY69

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF284

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KDVAVVFTEEELGLLDVSQRKLYRDVMLENFRNLLSVGHQLSHRDTFHFQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001032902

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PCSK9 Recombinant Rabbit monoclonal Antibody
HA725126H 100 µL

Human PCSK9 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Uroplakin II (UPK2) Human Gene Knockout Kit (CRISPR)
KN423168 1 Kit

Uroplakin II (UPK2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Ap3m1 activation kit by CRISPRa
GA205780 1 Kit

Mouse Ap3m1 activation kit by CRISPRa

Sign In for Pricing
View Details
QuicKey Pro Mouse IgG1 (Immunoglobulin G1) ELISA Kit
E-OSEL-M0013-01 24 Tests

QuicKey Pro Mouse IgG1 (Immunoglobulin G1) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Mouse IgG1 (Immunoglobulin G1) ELISA Kit
E-OSEL-M0013-02 48 Tests

QuicKey Pro Mouse IgG1 (Immunoglobulin G1) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Mouse IgG1 (Immunoglobulin G1) ELISA Kit
E-OSEL-M0013-03 96 Tests

QuicKey Pro Mouse IgG1 (Immunoglobulin G1) ELISA Kit

Sign In for Pricing
View Details