Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klf4 Rabbit Polyclonal Antibody (HRP)

Klf4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Zi, EZF, Gkl, Zie, Gklf

UniProt

Q60793

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRPAGAPTNRWREELSH

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_034767

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Gys2 shRNA (UAS) - Lentiviral mouse Gys2 shRNA (UAS, iRFP) plasmid
GTR15257560 1 Vial

Lentiviral mouse Gys2 shRNA (UAS) - Lentiviral mouse Gys2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Rat Hars2 Pre-designed siRNA Set B
SI206108B 1 Each

Rat Hars2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-CD224 LC Antibody
CPA3553-01 30 µL

Anti-CD224 LC Antibody

Sign In for Pricing
View Details
Anti-CD224 LC Antibody
CPA3553-02 50 μL

Anti-CD224 LC Antibody

Sign In for Pricing
View Details
Anti-CD224 LC Antibody
CPA3553-03 100 µL

Anti-CD224 LC Antibody

Sign In for Pricing
View Details
Anti-CD224 LC Antibody
CPA3553-04 200 µL

Anti-CD224 LC Antibody

Sign In for Pricing
View Details