Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIP13 Rabbit Polyclonal Antibody (HRP)

TRIP13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MVA3, OOMD9, 16E1BP

UniProt

Q15645

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRIP13

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDEAVGDLKQALPCVAESPTVHVEVHQRGSSTAKKEDINLSVRKLLNRHN

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004228

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Baculoviral IAP Repeat Containing Protein 2/3 (BIRC2/3) ELISA Kit
MBS9398395-01 48 Well

Canine Baculoviral IAP Repeat Containing Protein 2/3 (BIRC2/3) ELISA Kit

Sign In for Pricing
View Details
Canine Baculoviral IAP Repeat Containing Protein 2/3 (BIRC2/3) ELISA Kit
MBS9398395-02 96 Well

Canine Baculoviral IAP Repeat Containing Protein 2/3 (BIRC2/3) ELISA Kit

Sign In for Pricing
View Details
Canine Baculoviral IAP Repeat Containing Protein 2/3 (BIRC2/3) ELISA Kit
MBS9398395-03 5x 96 Well

Canine Baculoviral IAP Repeat Containing Protein 2/3 (BIRC2/3) ELISA Kit

Sign In for Pricing
View Details
Canine Baculoviral IAP Repeat Containing Protein 2/3 (BIRC2/3) ELISA Kit
MBS9398395-04 10x 96 Well

Canine Baculoviral IAP Repeat Containing Protein 2/3 (BIRC2/3) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal FCRL5/FCRL3 Antibody (307307) [mFluor Violet 450 SE]
FAB20871MFV450 0.1 mL

Mouse Monoclonal FCRL5/FCRL3 Antibody (307307) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Lentiviral mouse Lyz2 shRNA (UAS) - Lentiviral mouse Lyz2 shRNA (UAS, iRFP) plasmid
GTR15235156 1 Vial

Lentiviral mouse Lyz2 shRNA (UAS) - Lentiviral mouse Lyz2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details