Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUNX2 Rabbit Polyclonal Antibody (Biotin)

RUNX2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CCD, AML3, CCD1, CLCD, OSF2, CBFA1, OSF-2, PEA2aA, PEBP2aA, CBF-alpha-1

UniProt

Q13950

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RUNX2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004339

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFE2L3 Antibody
E51A01407 100 µL

NFE2L3 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Galectin-3 Antibody (A3A12) [Biotin]
NB300-538B 0.1 mL

Mouse Monoclonal Galectin-3 Antibody (A3A12) [Biotin]

Sign In for Pricing
View Details
BC048546 Mouse shRNA Plasmid (Locus ID 232400)
TR506984 1 Kit

BC048546 Mouse shRNA Plasmid (Locus ID 232400)

Sign In for Pricing
View Details
Dnmt3a shRNA (h) Lentiviral Particles
sc-37757-V 200 µL

Dnmt3a shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Rabbit LOW Molecular Weight Adiponectin ELISA Kit
MBS7270262-01 48 Well

Rabbit LOW Molecular Weight Adiponectin ELISA Kit

Sign In for Pricing
View Details
Rabbit LOW Molecular Weight Adiponectin ELISA Kit
MBS7270262-02 96 Well

Rabbit LOW Molecular Weight Adiponectin ELISA Kit

Sign In for Pricing
View Details