Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUNX2 Rabbit Polyclonal Antibody (Biotin)

RUNX2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CCD, AML3, CCD1, CLCD, OSF2, CBFA1, OSF-2, PEA2aA, PEBP2aA, CBF-alpha-1

UniProt

Q13950

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RUNX2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004339

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH-PTP2 Rabbit Polyclonal Antibody
E53P05849 100 µL

SH-PTP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PCDH11X (NM_001168360) Human Tagged ORF Clone
RG230703 10 µg

PCDH11X (NM_001168360) Human Tagged ORF Clone

Sign In for Pricing
View Details
CDC6 Mouse Monoclonal Antibody [Clone:1B3]
E45M18364 100 µg

CDC6 Mouse Monoclonal Antibody [Clone:1B3]

Sign In for Pricing
View Details
Mouse Ube2w ELISA KIT
ELI-51306m 96 Tests

Mouse Ube2w ELISA KIT

Sign In for Pricing
View Details
Smad4 (DPC4, Small Mothers Against Decapentaplegic Deleted in Pancreatic Carcinoma) discontinued
S1014-55 500 µL

Smad4 (DPC4, Small Mothers Against Decapentaplegic Deleted in Pancreatic Carcinoma) discontinued

Sign In for Pricing
View Details
FAM20C Rabbit Polyclonal Antibody (RBITC)
orb1057312 100 µL

FAM20C Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details