Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DTX1 Rabbit Polyclonal Antibody (HRP)

DTX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HDx-1, RNF140

UniProt

Q86Y01

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DTX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SRWRPYTATVCHHIENVLKEDARGSVVLGQVDAQLVPYIIDLQSMHQFRQ

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004407

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIP10 Antibody
ABD8087 100 µg

TRIP10 Antibody

Sign In for Pricing
View Details
Fmnl3 3'UTR Luciferase Stable Cell Line
TU106633 1.0 mL

Fmnl3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
NEI3 (NEI-3, NEI 3, Nei Endonuclease VIII-like 3) (HRP) discontinued
301412-HRP 100 µL

NEI3 (NEI-3, NEI 3, Nei Endonuclease VIII-like 3) (HRP) discontinued

Sign In for Pricing
View Details
Platelet Derived Growth Factor Receptor, Type B (PDGFRb) (Carboxyfluorescein)
P4258-23C 100 Tests

Platelet Derived Growth Factor Receptor, Type B (PDGFRb) (Carboxyfluorescein)

Sign In for Pricing
View Details
Recombinant Human HMGB3 Protein, N-His
orb3063220-01 50 µg

Recombinant Human HMGB3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human HMGB3 Protein, N-His
orb3063220-02 100 µg

Recombinant Human HMGB3 Protein, N-His

Sign In for Pricing
View Details