Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETV5 Rabbit Polyclonal Antibody (Biotin)

ETV5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ERM

UniProt

P41161

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ETV5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLA

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004445

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP4 ORF Vector (Human) (pORF)
ORF006254 1.0 µg DNA

MAP4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Beta Amyloid Antibody
orb3131536-01 1 mg

Beta Amyloid Antibody

Sign In for Pricing
View Details
Beta Amyloid Antibody
orb3131536-02 5 mg

Beta Amyloid Antibody

Sign In for Pricing
View Details
VGLU2, CT (Slc17a6, Dnpi, Vglut2, Vesicular glutamate transporter 2, Differentiation-associated BNPI, Differentiation-associated Na (+) -dependent inorganic phosphate cotransporter, Solute carrier family 17 member 6) (MaxLight 550) discontinued
043755-ML550 100 µL

VGLU2, CT (Slc17a6, Dnpi, Vglut2, Vesicular glutamate transporter 2, Differentiation-associated BNPI, Differentiation-associated Na (+) -dependent inorganic phosphate cotransporter, Solute carrier family 17 member 6) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Human THAP domain-containing protein 10, THAP10 ELISA Kit
MBS9335140-01 48 Well

Human THAP domain-containing protein 10, THAP10 ELISA Kit

Sign In for Pricing
View Details
Human THAP domain-containing protein 10, THAP10 ELISA Kit
MBS9335140-02 96 Well

Human THAP domain-containing protein 10, THAP10 ELISA Kit

Sign In for Pricing
View Details