Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF1 Rabbit Polyclonal Antibody (FITC)

SF1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BBP, MBBP, ZFM1, ZNF162, D11S636, ZCCHC25

UniProt

Q15637

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SF1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004621

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transmembrane Protease, Serine 3 (TMPRSS3) Antibody
abx219022 100 µg

Transmembrane Protease, Serine 3 (TMPRSS3) Antibody

Sign In for Pricing
View Details
ALDH1A2 (NM_170697) Human Tagged ORF Clone
RG216668 10 µg

ALDH1A2 (NM_170697) Human Tagged ORF Clone

Sign In for Pricing
View Details
CKB CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
16215154 3x 1.0 µg DNA

CKB CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
TAB1 Antibody [M21E14]
C19499-50uL 50 μL

TAB1 Antibody [M21E14]

Sign In for Pricing
View Details
Protocadherin Gamma (pan) Antibody
abx441619 100 µg

Protocadherin Gamma (pan) Antibody

Sign In for Pricing
View Details
Lentiviral human KRTAP19-2 sgRNA gene knockout kit - Lentiviral human KRTAP19-2 sgRNA gene knockout kit (plasmid)
GTR15356690 1 Vial

Lentiviral human KRTAP19-2 sgRNA gene knockout kit - Lentiviral human KRTAP19-2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details