Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cnot8 Rabbit Polyclonal Antibody (Biotin)

Cnot8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AA536816, AU015770, AU043059, 1500015I04Rik, 1810022F04Rik

UniProt

Q9D8X5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_081225

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdc4 (FBXW7, F-box and WD repeat domain containing 7, AGO, Archipelago homolog, DKFZp686F23254, F-box/WD repeat-containing protein 7, F-box and WD-40 domain-containing protein 7, F-box protein FBX30, FBW6, FBW7, FBX30, FBXO30, FBXW6, FLJ11071, FLJ16457, hAgo, hCdc4, SEL10, SEL-10) (MaxLight 490)
C2549-70-ML490 100 µL

Cdc4 (FBXW7, F-box and WD repeat domain containing 7, AGO, Archipelago homolog, DKFZp686F23254, F-box/WD repeat-containing protein 7, F-box and WD-40 domain-containing protein 7, F-box protein FBX30, FBW6, FBW7, FBX30, FBXO30, FBXW6, FLJ11071, FLJ16457, hAgo, hCdc4, SEL10, SEL-10) (MaxLight 490)

Sign In for Pricing
View Details
Cav1.3 Ca2+ channel Antibody
E55A14813 100 µg

Cav1.3 Ca2+ channel Antibody

Sign In for Pricing
View Details
PRRC2C Antibody Blocking Peptide
orb1508314 500 µg

PRRC2C Antibody Blocking Peptide

Sign In for Pricing
View Details
Europium trichloride 99.9%
E16923-01 1 g

Europium trichloride 99.9%

Sign In for Pricing
View Details
Europium trichloride 99.9%
E16923-02 5 g

Europium trichloride 99.9%

Sign In for Pricing
View Details
Europium trichloride 99.9%
E16923-03 25 g

Europium trichloride 99.9%

Sign In for Pricing
View Details