Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cnot8 Rabbit Polyclonal Antibody (HRP)

Cnot8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AA536816, AU015770, AU043059, 1500015I04Rik, 1810022F04Rik

UniProt

Q9D8X5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_081225

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD80 Detection Set (Risk Free)
orb1227442 1 Each

CD80 Detection Set (Risk Free)

Sign In for Pricing
View Details
ZNRF4 Antibody Blocking peptide
orb1452737 500 µg

ZNRF4 Antibody Blocking peptide

Sign In for Pricing
View Details
FAM83A (NM_032899) Human Over-expression Lysate
LS084985 100 µg

FAM83A (NM_032899) Human Over-expression Lysate

Sign In for Pricing
View Details
Obg-Like ATPase 1 Polyclonal Conjugated Antibody
MBS9450698-01 0.1 mL (Biotin)

Obg-Like ATPase 1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Obg-Like ATPase 1 Polyclonal Conjugated Antibody
MBS9450698-02 0.1 mL (AF350)

Obg-Like ATPase 1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Obg-Like ATPase 1 Polyclonal Conjugated Antibody
MBS9450698-03 0.1 mL (AF405)

Obg-Like ATPase 1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details