Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cnot8 Rabbit Polyclonal Antibody (Biotin)

Cnot8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AA536816, AU015770, AU043059, 1500015I04Rik, 1810022F04Rik

UniProt

Q9D8X5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDCAQEKMSILAM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_081225

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lemmatoxin C
MBS5782198 Inquire

Lemmatoxin C

Sign In for Pricing
View Details
Recombinant Human ALKBH5 Protein, N-His
HA341012-01 50 µg

Recombinant Human ALKBH5 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ALKBH5 Protein, N-His
HA341012-02 100 µg

Recombinant Human ALKBH5 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ALKBH5 Protein, N-His
HA341012-03 1 mg

Recombinant Human ALKBH5 Protein, N-His

Sign In for Pricing
View Details
Tissue Genomic DNA, Stomach
CD563742 5 µg

Tissue Genomic DNA, Stomach

Sign In for Pricing
View Details
CD55 (CD55 Antigen, CD55 Molecule, Complement Decay Accelerating Factor, CR, Cromer Blood Group Antigen, Cromer Blood Group System, Decay Accelerating Factor for Complement, DAF, TC) (MaxLight 750)
MBS6256777-01 0.1 mL

CD55 (CD55 Antigen, CD55 Molecule, Complement Decay Accelerating Factor, CR, Cromer Blood Group Antigen, Cromer Blood Group System, Decay Accelerating Factor for Complement, DAF, TC) (MaxLight 750)

Sign In for Pricing
View Details