Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cnot8 Rabbit Polyclonal Antibody (FITC)

Cnot8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AA536816, AU015770, AU043059, 1500015I04Rik, 1810022F04Rik

UniProt

Q9D8X5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDCAQEKMSILAM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_081225

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Heat Shock 40kDa Protein 4 (HSPF4) ELISA Kit
MBS2127344-01 24 Strip Well

Mouse Heat Shock 40kDa Protein 4 (HSPF4) ELISA Kit

Sign In for Pricing
View Details
Mouse Heat Shock 40kDa Protein 4 (HSPF4) ELISA Kit
MBS2127344-02 48 Well

Mouse Heat Shock 40kDa Protein 4 (HSPF4) ELISA Kit

Sign In for Pricing
View Details
Mouse Heat Shock 40kDa Protein 4 (HSPF4) ELISA Kit
MBS2127344-03 96 Well

Mouse Heat Shock 40kDa Protein 4 (HSPF4) ELISA Kit

Sign In for Pricing
View Details
Mouse Heat Shock 40kDa Protein 4 (HSPF4) ELISA Kit
MBS2127344-04 5x 96 Well

Mouse Heat Shock 40kDa Protein 4 (HSPF4) ELISA Kit

Sign In for Pricing
View Details
Mouse Heat Shock 40kDa Protein 4 (HSPF4) ELISA Kit
MBS2127344-05 10x 96 Well

Mouse Heat Shock 40kDa Protein 4 (HSPF4) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human KIFC1 sgRNA gene knockout kit - Lentiviral human KIFC1 sgRNA gene knockout kit (25)
GTR15387699 1 Vial

Lentiviral human KIFC1 sgRNA gene knockout kit - Lentiviral human KIFC1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details