Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cnot8 Rabbit Polyclonal Antibody (HRP)

Cnot8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AA536816, AU015770, AU043059, 1500015I04Rik, 1810022F04Rik

UniProt

Q9D8X5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDCAQEKMSILAM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_081225

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JADE1 Rabbit Polyclonal Antibody (Fluoro550)
orb3099912 100 µg

JADE1 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Human Mesothelin / MSLN (296-580) Recombinant Protein His Tag Lyophilized 100UG
IHUMSLN296580RHISLY100UG 100 µg

Human Mesothelin / MSLN (296-580) Recombinant Protein His Tag Lyophilized 100UG

Sign In for Pricing
View Details
PYCARD Polyclonal Antibody
E-AB-93265-01 60 µL

PYCARD Polyclonal Antibody

Sign In for Pricing
View Details
PYCARD Polyclonal Antibody
E-AB-93265-02 120 µL

PYCARD Polyclonal Antibody

Sign In for Pricing
View Details
PYCARD Polyclonal Antibody
E-AB-93265-03 200 µL

PYCARD Polyclonal Antibody

Sign In for Pricing
View Details
NEU2 Polyclonal Conjugated Antibody
orb1625721 100 µL

NEU2 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details