Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cnot8 Rabbit Polyclonal Antibody (HRP)

Cnot8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AA536816, AU015770, AU043059, 1500015I04Rik, 1810022F04Rik

UniProt

Q9D8X5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDCAQEKMSILAM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_081225

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human AKR1C3 Protein
MBS8248523-01 0.01 mg

Recombinant Human AKR1C3 Protein

Sign In for Pricing
View Details
Recombinant Human AKR1C3 Protein
MBS8248523-02 0.05 mg

Recombinant Human AKR1C3 Protein

Sign In for Pricing
View Details
Recombinant Human AKR1C3 Protein
MBS8248523-03 0.5 mg

Recombinant Human AKR1C3 Protein

Sign In for Pricing
View Details
Recombinant Human AKR1C3 Protein
MBS8248523-04 5x 0.5 mg

Recombinant Human AKR1C3 Protein

Sign In for Pricing
View Details
2’-Deoxyguanosine-5’-Triphosphate, Sodium Salt (dGTP) Powder, BioGenomicsTM
D3189-01-01 100 mg

2’-Deoxyguanosine-5’-Triphosphate, Sodium Salt (dGTP) Powder, BioGenomicsTM

Sign In for Pricing
View Details
2’-Deoxyguanosine-5’-Triphosphate, Sodium Salt (dGTP) Powder, BioGenomicsTM
D3189-01-02 250 mg

2’-Deoxyguanosine-5’-Triphosphate, Sodium Salt (dGTP) Powder, BioGenomicsTM

Sign In for Pricing
View Details