Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ciao1 Rabbit Polyclonal Antibody (HRP)

Ciao1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Wdr3, Wdr39, AW210570

UniProt

Q99KN2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Ciao1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKDSLVLQSRVPAHPDSRCWFLAWNPSGTLLASCGGDRKIRIWGTEGDSW

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079572

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CC2D1B Human Gene Knockout Kit (CRISPR)
KN419061 1 Kit

CC2D1B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS708506 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Human EMID2 (COL26A1) activation kit by CRISPRa
GA115264 1 Kit

Human EMID2 (COL26A1) activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS635862 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
VILIP1 Recombinant Rabbit Monoclonal Antibody [PSH0-08]
HA721261 100 µL

VILIP1 Recombinant Rabbit Monoclonal Antibody [PSH0-08]

Sign In for Pricing
View Details
CKS1 (CKS1B) (NM_001826) Human Over-expression Lysate
LC400692 20 µg

CKS1 (CKS1B) (NM_001826) Human Over-expression Lysate

Sign In for Pricing
View Details