Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ciao1 Rabbit Polyclonal Antibody (HRP)

Ciao1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Wdr3, Wdr39, AW210570

UniProt

Q99KN2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Ciao1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKDSLVLQSRVPAHPDSRCWFLAWNPSGTLLASCGGDRKIRIWGTEGDSW

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079572

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[2-(6-Amino-9H-purin-9-yl)ethanol-d4
TRC-A628912-25MG 25 mg

[2-(6-Amino-9H-purin-9-yl)ethanol-d4

Sign In for Pricing
View Details
MelanA (MLANA) Mouse Monoclonal Antibody [Clone ID: M2-9E3]
AM32813PU-T 20 µg

MelanA (MLANA) Mouse Monoclonal Antibody [Clone ID: M2-9E3]

Sign In for Pricing
View Details
Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2922), CF568 conjugate, 0.1mg/mL
BNC682922-500 1x 500 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2922), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Syntrophin alpha 1 (SNTA1) Mouse Monoclonal Antibody [Clone ID: AT1E1]
AM50039PU-N 100 µL

Syntrophin alpha 1 (SNTA1) Mouse Monoclonal Antibody [Clone ID: AT1E1]

Sign In for Pricing
View Details
FAM118A (NM_001104595) Human Over-expression Lysate
LC426209 20 µg

FAM118A (NM_001104595) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Urinary bladder
CS808855 5x 5 µm

Tissue FFPE Sections, Urinary bladder

Sign In for Pricing
View Details