Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK5 Rabbit Polyclonal Antibody (FITC)

CDK5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LIS7, PSSALRE

UniProt

Q00535

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CDK5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFC

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_004926

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATH1, NT (Protein Atonal Homolog 1, Helix-loop-helix Protein hATH-1, Class A Basic Helix-loop-helix Protein 14, bHLHa14, ATOH1, MATH1, HATH1) (MaxLight 490)
MBS6464340-01 0.1 mL

ATH1, NT (Protein Atonal Homolog 1, Helix-loop-helix Protein hATH-1, Class A Basic Helix-loop-helix Protein 14, bHLHa14, ATOH1, MATH1, HATH1) (MaxLight 490)

Sign In for Pricing
View Details
ATH1, NT (Protein Atonal Homolog 1, Helix-loop-helix Protein hATH-1, Class A Basic Helix-loop-helix Protein 14, bHLHa14, ATOH1, MATH1, HATH1) (MaxLight 490)
MBS6464340-02 5x 0.1 mL

ATH1, NT (Protein Atonal Homolog 1, Helix-loop-helix Protein hATH-1, Class A Basic Helix-loop-helix Protein 14, bHLHa14, ATOH1, MATH1, HATH1) (MaxLight 490)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Galectin 1 (GAL1)
MBS2041051-01 0.1 mL

FITC-Linked Polyclonal Antibody to Galectin 1 (GAL1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Galectin 1 (GAL1)
MBS2041051-02 0.2 mL

FITC-Linked Polyclonal Antibody to Galectin 1 (GAL1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Galectin 1 (GAL1)
MBS2041051-03 0.5 mL

FITC-Linked Polyclonal Antibody to Galectin 1 (GAL1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Galectin 1 (GAL1)
MBS2041051-04 1 mL

FITC-Linked Polyclonal Antibody to Galectin 1 (GAL1)

Sign In for Pricing
View Details