Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDAC1 Rabbit Polyclonal Antibody (FITC)

HDAC1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HD1, RPD3, KDAC1, GON-10, RPD3L1

UniProt

Q13547

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human HDAC1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004955

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL31RA (Interleukin 31 Receptor A, CRL, CRL3, GLM-R, GLMR, GPL, IL-31RA, MGC125346, PRO21384) (MaxLight 750) discontinued
247585-ML750 100 µL

IL31RA (Interleukin 31 Receptor A, CRL, CRL3, GLM-R, GLMR, GPL, IL-31RA, MGC125346, PRO21384) (MaxLight 750) discontinued

Sign In for Pricing
View Details
ACTB Antibody, FITC conjugated
CSB-PA01629C0Rb-01 50 µg

ACTB Antibody, FITC conjugated

Sign In for Pricing
View Details
ACTB Antibody, FITC conjugated
CSB-PA01629C0Rb-02 100 µg

ACTB Antibody, FITC conjugated

Sign In for Pricing
View Details
SORT1 Antibody
A52300-50UL 50 μL

SORT1 Antibody

Sign In for Pricing
View Details
LARP6 (NM_018357) Human Tagged Lenti ORF Clone
RC204234L3 10 µg

LARP6 (NM_018357) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Porcine Contactin Associated Protein Like Protein 4 ELISA Kit
MBS747806-01 48 Well

Porcine Contactin Associated Protein Like Protein 4 ELISA Kit

Sign In for Pricing
View Details