Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDAC1 Rabbit Polyclonal Antibody (HRP)

HDAC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HD1, RPD3, KDAC1, GON-10, RPD3L1

UniProt

Q13547

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human HDAC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004955

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD40 Mouse Monoclonal Antibody [Clone ID: OTI6A11]
CF813200 100 µg

CD40 Mouse Monoclonal Antibody [Clone ID: OTI6A11]

Sign In for Pricing
View Details
MelanA (MLANA) Mouse Monoclonal Antibody [Clone ID: OTI4F12]
CF807227 100 µg

MelanA (MLANA) Mouse Monoclonal Antibody [Clone ID: OTI4F12]

Sign In for Pricing
View Details
1-Adamantanamine Sulfate
TRC-A576010-250MG 250 mg

1-Adamantanamine Sulfate

Sign In for Pricing
View Details
TRX Tag Polyclonal Antibody
E-AB-40551-01 25 µL

TRX Tag Polyclonal Antibody

Sign In for Pricing
View Details
TRX Tag Polyclonal Antibody
E-AB-40551-02 100 µL

TRX Tag Polyclonal Antibody

Sign In for Pricing
View Details
ASC1 Recombinant Rabbit Monoclonal Antibody [PSH0-26]
HA721306 100 µL

ASC1 Recombinant Rabbit Monoclonal Antibody [PSH0-26]

Sign In for Pricing
View Details