Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nfkbil1 Rabbit Polyclonal Antibody (HRP)

Nfkbil1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IKBL, Def-7, ikappaBL

UniProt

O88995

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RGPPLEEQGALKRYLRVQQVRWHPDRFLQRFRSQIETWELGRVMGAVTAL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_035039

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-p23 (Recombinant Rabbit, Monoclonal, IgG)
A118132 100 µL

Anti-p23 (Recombinant Rabbit, Monoclonal, IgG)

Sign In for Pricing
View Details
(Pro³)-Gastric Inhibitory Polypeptide (human)
4062141.1 1 mg

(Pro³)-Gastric Inhibitory Polypeptide (human)

Sign In for Pricing
View Details
Monkey Sorting Nexin 1 (SNX1) ELISA Kit
MBS9354289-01 48 Well

Monkey Sorting Nexin 1 (SNX1) ELISA Kit

Sign In for Pricing
View Details
Monkey Sorting Nexin 1 (SNX1) ELISA Kit
MBS9354289-02 96 Well

Monkey Sorting Nexin 1 (SNX1) ELISA Kit

Sign In for Pricing
View Details
Monkey Sorting Nexin 1 (SNX1) ELISA Kit
MBS9354289-03 5x 96 Well

Monkey Sorting Nexin 1 (SNX1) ELISA Kit

Sign In for Pricing
View Details
Monkey Sorting Nexin 1 (SNX1) ELISA Kit
MBS9354289-04 10x 96 Well

Monkey Sorting Nexin 1 (SNX1) ELISA Kit

Sign In for Pricing
View Details