Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRF1 Rabbit Polyclonal Antibody (FITC)

NRF1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ALPHA-PAL

UniProt

Q16656

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NRF1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPED

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005002

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUCLG1 antibody
70R-20637 50 ul

SUCLG1 antibody

Sign In for Pricing
View Details
GAS8 Protein Vector (Rat) (pPB-N-His)
PV269695 500 ng

GAS8 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Cyp4a1 Rat siRNA Oligo Duplex (Locus ID 50549)
SR507425 1 Kit

Cyp4a1 Rat siRNA Oligo Duplex (Locus ID 50549)

Sign In for Pricing
View Details
Polyclonal antibody-Canine B1 bradykinin receptor
PA-RA-07628 100 µg

Polyclonal antibody-Canine B1 bradykinin receptor

Sign In for Pricing
View Details
FOXO1, Phosphorylated (Thr24) (FKHR, Forkhead Box Protein O1, Forkhead Box Protein O1A, Forkhead In Rhabdomyosarcoma, FOXO1A) (MaxLight 750)
MBS6269592-01 0.1 mL

FOXO1, Phosphorylated (Thr24) (FKHR, Forkhead Box Protein O1, Forkhead Box Protein O1A, Forkhead In Rhabdomyosarcoma, FOXO1A) (MaxLight 750)

Sign In for Pricing
View Details
FOXO1, Phosphorylated (Thr24) (FKHR, Forkhead Box Protein O1, Forkhead Box Protein O1A, Forkhead In Rhabdomyosarcoma, FOXO1A) (MaxLight 750)
MBS6269592-02 5x 0.1 mL

FOXO1, Phosphorylated (Thr24) (FKHR, Forkhead Box Protein O1, Forkhead Box Protein O1A, Forkhead In Rhabdomyosarcoma, FOXO1A) (MaxLight 750)

Sign In for Pricing
View Details