Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rbbp5 Rabbit Polyclonal Antibody (HRP)

Rbbp5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C330016J05, 4933411J24Rik

UniProt

Q8BX09

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLESFGQNYPEEADGTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFL

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766105

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VOM2R71 Adenovirus (Rat)
50151056 1.0 mL

VOM2R71 Adenovirus (Rat)

Sign In for Pricing
View Details
USF1 protein (His tag)
80R-3580 0.05 mg

USF1 protein (His tag)

Sign In for Pricing
View Details
HELB Knockout HAP1 Polyclonal Cells
ARG22483 1 Million

HELB Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
Human 24 (S) -Hydroxycholesterol,24S-HC ELISA KIT
EA0188Hu-01 96 Well

Human 24 (S) -Hydroxycholesterol,24S-HC ELISA KIT

Sign In for Pricing
View Details
Human 24 (S) -Hydroxycholesterol,24S-HC ELISA KIT
EA0188Hu-02 5x 96 Tests

Human 24 (S) -Hydroxycholesterol,24S-HC ELISA KIT

Sign In for Pricing
View Details
Human 24 (S) -Hydroxycholesterol,24S-HC ELISA KIT
EA0188Hu-03 10x 96 Tests

Human 24 (S) -Hydroxycholesterol,24S-HC ELISA KIT

Sign In for Pricing
View Details