Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rbbp5 Rabbit Polyclonal Antibody (HRP)

Rbbp5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C330016J05, 4933411J24Rik

UniProt

Q8BX09

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLESFGQNYPEEADGTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFL

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766105

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Easypro Rat Prothrombin Fragment 1+2 (F1+2) ELISA Kit
FY-ER2046S 96 Well

Easypro Rat Prothrombin Fragment 1+2 (F1+2) ELISA Kit

Sign In for Pricing
View Details
Collagen Type I (HRP) discontinued
C7510-12J-HRP 100 µL

Collagen Type I (HRP) discontinued

Sign In for Pricing
View Details
SMUBP2 Rabbit Polyclonal Antibody (Cy3)
orb983956 100 µL

SMUBP2 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
MPZL2 Knockout AGS Polyclonal Cells
ARG2525 1 Million

MPZL2 Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
Recombinant Mouse Carboxylesterase 2E/CES2E (C-6His)
32-8613-10 10 µg

Recombinant Mouse Carboxylesterase 2E/CES2E (C-6His)

Sign In for Pricing
View Details
Anti-PRKG1 antibody
PAab06786 100 µg

Anti-PRKG1 antibody

Sign In for Pricing
View Details