Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIM2 Rabbit Polyclonal Antibody (HRP)

SIM2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SIM, bHLHe15, HMC13F06, HMC29C01

UniProt

Q14190

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SIM2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYL

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005060

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin A11 Rabbit Polyclonal Antibody
orb377923-01 30 µL

Annexin A11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Annexin A11 Rabbit Polyclonal Antibody
orb377923-02 50 μL

Annexin A11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Annexin A11 Rabbit Polyclonal Antibody
orb377923-03 100 µL

Annexin A11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Annexin A11 Rabbit Polyclonal Antibody
orb377923-04 200 µL

Annexin A11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CALR (CALR, CRTC, Calreticulin, CRP55, Calregulin, Endoplasmic reticulum resident protein 60, HACBP, grp60) (AP) discontinued
033154-AP 200 µL

CALR (CALR, CRTC, Calreticulin, CRP55, Calregulin, Endoplasmic reticulum resident protein 60, HACBP, grp60) (AP) discontinued

Sign In for Pricing
View Details
V-set and immunoglobulin domain-containing protein 1 (VSIG1) Bovine ELISA Kit
I1688 96 Tests

V-set and immunoglobulin domain-containing protein 1 (VSIG1) Bovine ELISA Kit

Sign In for Pricing
View Details