Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEBPD Rabbit Polyclonal Antibody (HRP)

CEBPD Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CELF, CRP3, C/EBP-delta, NF-IL6-beta

UniProt

P49716

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CEBPD

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_005186

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPA1 siRNA (Mouse)
CRM7411-01 15 nmol

PPA1 siRNA (Mouse)

Sign In for Pricing
View Details
PPA1 siRNA (Mouse)
CRM7411-02 30 nmol

PPA1 siRNA (Mouse)

Sign In for Pricing
View Details
SENP7 Rabbit Polyclonal Antibody (BF680)
orb2381371 100 µL

SENP7 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
CCDC141 Rabbit Polyclonal Antibody (FITC)
orb2087067 100 µL

CCDC141 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Fatty Acid Binding Protein 1, Liver (FABP1)
MBS2056586-01 0.1 mL

FITC-Linked Polyclonal Antibody to Fatty Acid Binding Protein 1, Liver (FABP1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Fatty Acid Binding Protein 1, Liver (FABP1)
MBS2056586-02 0.2 mL

FITC-Linked Polyclonal Antibody to Fatty Acid Binding Protein 1, Liver (FABP1)

Sign In for Pricing
View Details