Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEBPD Rabbit Polyclonal Antibody (HRP)

CEBPD Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CELF, CRP3, C/EBP-delta, NF-IL6-beta

UniProt

P49716

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CEBPD

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_005186

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFE3 Antibody (FITC)
orb401582-01 50 µg

TFE3 Antibody (FITC)

Sign In for Pricing
View Details
TFE3 Antibody (FITC)
orb401582-02 100 µg

TFE3 Antibody (FITC)

Sign In for Pricing
View Details
Mouse Anti Mouse AIF1 Monoclonal Clone 5G4E7
MBS8421709-01 0.12 mL

Mouse Anti Mouse AIF1 Monoclonal Clone 5G4E7

Sign In for Pricing
View Details
Mouse Anti Mouse AIF1 Monoclonal Clone 5G4E7
MBS8421709-02 5x 0.12 mL

Mouse Anti Mouse AIF1 Monoclonal Clone 5G4E7

Sign In for Pricing
View Details
Interferon Regulatory Protein 4 Transactivation Domain (IRF4, MUM-1) discontinued
I7662-71G 100 µg

Interferon Regulatory Protein 4 Transactivation Domain (IRF4, MUM-1) discontinued

Sign In for Pricing
View Details
Human KCNQ5 Pre-designed siRNA Set B
SI008059B 1 Each

Human KCNQ5 Pre-designed siRNA Set B

Sign In for Pricing
View Details