Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLX3 Rabbit Polyclonal Antibody (HRP)

DLX3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI4, TDO

UniProt

O60479

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DLX3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast

Tested Applications

WB

NCBI Accession Number

NP_005211

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat BMG/β2-MG Antibody Pair Set
E-KAB-0097 50 µL & 100 µg

Rat BMG/β2-MG Antibody Pair Set

Sign In for Pricing
View Details
YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (rYBX1/2430), CF488A conjugate, 0.1mg/mL
BNC882570-500 1x 500 µL

YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (rYBX1/2430), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD1 (PDCD1) Human Recombinant Protein
TP723948 100 µg

PD1 (PDCD1) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Myometrium
CS500491 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details
FBXL18 (NM_024963) Human Recombinant Protein
TP320401L 1 mg

FBXL18 (NM_024963) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS500666 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details