Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELK1 Rabbit Polyclonal Antibody (HRP)

ELK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P19419

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ELK1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_005220

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Mitochondrial import inner membrane translocase subunit Tim9 (TIMM9B) ELISA kit
GTR10471436 96 Well

Bovine Mitochondrial import inner membrane translocase subunit Tim9 (TIMM9B) ELISA kit

Sign In for Pricing
View Details
Quavonlimab (Anti-CTLA-4 / CD152)
C00747-1mg*5 5x 1mg

Quavonlimab (Anti-CTLA-4 / CD152)

Sign In for Pricing
View Details
ROCK-1 (Rho-associated Coiled-coil-containing Protein Kinase 1, ROCK1, MGC131603, MGC43611, NY-REN-35 Antigen, p160 ROCK1, p160ROCK, Renal Carcinoma Antigen NY-REN-35, Rho-associated Protein Kinase 1) (PE)
MBS6498114-01 0.1 mL

ROCK-1 (Rho-associated Coiled-coil-containing Protein Kinase 1, ROCK1, MGC131603, MGC43611, NY-REN-35 Antigen, p160 ROCK1, p160ROCK, Renal Carcinoma Antigen NY-REN-35, Rho-associated Protein Kinase 1) (PE)

Sign In for Pricing
View Details
ROCK-1 (Rho-associated Coiled-coil-containing Protein Kinase 1, ROCK1, MGC131603, MGC43611, NY-REN-35 Antigen, p160 ROCK1, p160ROCK, Renal Carcinoma Antigen NY-REN-35, Rho-associated Protein Kinase 1) (PE)
MBS6498114-02 5x 0.1 mL

ROCK-1 (Rho-associated Coiled-coil-containing Protein Kinase 1, ROCK1, MGC131603, MGC43611, NY-REN-35 Antigen, p160 ROCK1, p160ROCK, Renal Carcinoma Antigen NY-REN-35, Rho-associated Protein Kinase 1) (PE)

Sign In for Pricing
View Details
Sec63 3'UTR Luciferase Stable Cell Line
TU118511 1.0 mL

Sec63 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PI4K2A, NT (Phosphatidylinositol 4-kinase Type 2 alpha, PIK42A, Phosphatidylinositol 4-kinase Type II-alpha, PI4KII, DKFZp761G1923, RP11-548K23.6) (AP) discontinued
P4186-27N-AP 200 µL

PI4K2A, NT (Phosphatidylinositol 4-kinase Type 2 alpha, PIK42A, Phosphatidylinositol 4-kinase Type II-alpha, PI4KII, DKFZp761G1923, RP11-548K23.6) (AP) discontinued

Sign In for Pricing
View Details