Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Elk3 Rabbit Polyclonal Antibody (Biotin)

Elk3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

E, Ne, Sa, Erp, Net, Etrp, Sap-2, D430049E23Rik

UniProt

P41971

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MESAITLWQFLLHLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_038536

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAL, CT (GAL, GAL1, GALN, GLNN, Galanin peptides, Galanin, Galanin message-associated peptide) (Biotin)
MBS6301051-01 0.2 mL

GAL, CT (GAL, GAL1, GALN, GLNN, Galanin peptides, Galanin, Galanin message-associated peptide) (Biotin)

Sign In for Pricing
View Details
GAL, CT (GAL, GAL1, GALN, GLNN, Galanin peptides, Galanin, Galanin message-associated peptide) (Biotin)
MBS6301051-02 5x 0.2 mL

GAL, CT (GAL, GAL1, GALN, GLNN, Galanin peptides, Galanin, Galanin message-associated peptide) (Biotin)

Sign In for Pricing
View Details
ATN1 Rabbit Polyclonal Antibody (FITC)
orb2129619 100 µL

ATN1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Recombinant Rat Protein NDRG1 (Ndrg1)
MBS1379866-01 0.02 mg (E-Coli)

Recombinant Rat Protein NDRG1 (Ndrg1)

Sign In for Pricing
View Details
Recombinant Rat Protein NDRG1 (Ndrg1)
MBS1379866-02 0.02 mg (Yeast)

Recombinant Rat Protein NDRG1 (Ndrg1)

Sign In for Pricing
View Details
Recombinant Rat Protein NDRG1 (Ndrg1)
MBS1379866-03 0.1 mg (E-Coli)

Recombinant Rat Protein NDRG1 (Ndrg1)

Sign In for Pricing
View Details