Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Elk3 Rabbit Polyclonal Antibody (FITC)

Elk3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

E, Ne, Sa, Erp, Net, Etrp, Sap-2, D430049E23Rik

UniProt

P41971

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MESAITLWQFLLHLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_038536

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIPA1L2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
43796111 3x 1.0 µg

SIPA1L2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
PLSCR3 Lentiviral Activation Particles (h)
sc-408265-LAC 200 µL

PLSCR3 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Rpl10 Mouse siRNA Oligo Duplex (Locus ID 110954)
SR405659 1 Kit

Rpl10 Mouse siRNA Oligo Duplex (Locus ID 110954)

Sign In for Pricing
View Details
ZDHHC14 Rabbit Polyclonal Antibody (AP)
orb954544 100 µL

ZDHHC14 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Lentiviral mouse Mapk3 shRNA (UAS) - Lentiviral mouse Mapk3 shRNA (UAS, iRFP) plasmid
GTR15165292 1 Vial

Lentiviral mouse Mapk3 shRNA (UAS) - Lentiviral mouse Mapk3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Neu-Oncogen (C-erb B2) discontinued
169165 1 mL

Neu-Oncogen (C-erb B2) discontinued

Sign In for Pricing
View Details