Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETS2 Rabbit Polyclonal Antibody (FITC)

ETS2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ETS2IT1

UniProt

P15036

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ETS2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVC

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005230

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibroblast Growth Factor Receptor 1 (FGFR1, Basic fibroblast growth factor receptor 1, BFGFR, bFGF-R, CD331, CEK, c-fgr, FGFBR, FGFR-1, FLG, FLJ99988, FLT2, Fms-like tyrosine kinase 2, H2, H3, H4, H5, HBGFR, KAL2, N-SAM, OGD) (BSA & Azide Free) discontinued
F4305-02B 100 µL

Fibroblast Growth Factor Receptor 1 (FGFR1, Basic fibroblast growth factor receptor 1, BFGFR, bFGF-R, CD331, CEK, c-fgr, FGFBR, FGFR-1, FLG, FLJ99988, FLT2, Fms-like tyrosine kinase 2, H2, H3, H4, H5, HBGFR, KAL2, N-SAM, OGD) (BSA & Azide Free) discontinued

Sign In for Pricing
View Details
Nol8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
31986116 3x 1.0 µg

Nol8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Anti-Cryptochrome I/CRY1 Antibody Picoband®
PB9540 100 µg/Vial

Anti-Cryptochrome I/CRY1 Antibody Picoband®

Sign In for Pricing
View Details
Sigirr sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4982704 1.0 µg DNA

Sigirr sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Bovine Olfactory receptor 2G2 (OR2G2) ELISA Kit
MBS7221868-01 48 Well

Bovine Olfactory receptor 2G2 (OR2G2) ELISA Kit

Sign In for Pricing
View Details
Bovine Olfactory receptor 2G2 (OR2G2) ELISA Kit
MBS7221868-02 96 Well

Bovine Olfactory receptor 2G2 (OR2G2) ELISA Kit

Sign In for Pricing
View Details