Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSCL Rabbit Polyclonal Antibody (Biotin)

GSCL Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GSCL

UniProt

O15499

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GSCL

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LEALFVQNQYPDVSTRERLAGRIRLREERVEVWFKNRRAKWRHQKRASAS

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_005306

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

MID2 (Probable E3 Ubiquitin-protein Ligase MID2, Midin-2, Midline Defect 2, Midline-2, RING Finger Protein 60, Tripartite Motif-containing Protein 1, MID2, FXY2, RNF60, TRIM1)
406715-01 50 µL

MID2 (Probable E3 Ubiquitin-protein Ligase MID2, Midin-2, Midline Defect 2, Midline-2, RING Finger Protein 60, Tripartite Motif-containing Protein 1, MID2, FXY2, RNF60, TRIM1)

Sign In for Pricing
View Details
MID2 (Probable E3 Ubiquitin-protein Ligase MID2, Midin-2, Midline Defect 2, Midline-2, RING Finger Protein 60, Tripartite Motif-containing Protein 1, MID2, FXY2, RNF60, TRIM1)
406715-02 100 µL

MID2 (Probable E3 Ubiquitin-protein Ligase MID2, Midin-2, Midline Defect 2, Midline-2, RING Finger Protein 60, Tripartite Motif-containing Protein 1, MID2, FXY2, RNF60, TRIM1)

Sign In for Pricing
View Details
Gm15127-set siRNA/shRNA/RNAi Lentivector (Mouse)
21898094 4x 500 ng

Gm15127-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
ST18 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV653808 1.0 µg DNA

ST18 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
DAB2 (NM_001343) Human Tagged ORF Clone
RG200481 10 µg

DAB2 (NM_001343) Human Tagged ORF Clone

Sign In for Pricing
View Details
WDR85, NT (WDR85, C9orf112, WD repeat-containing protein 85) (AP) discontinued
043858-AP 200 µL

WDR85, NT (WDR85, C9orf112, WD repeat-containing protein 85) (AP) discontinued

Sign In for Pricing
View Details