Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYB Rabbit Polyclonal Antibody (FITC)

MYB Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Efg, Cmyb, c-myb, c-myb_CDS

UniProt

P10242

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MYB

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AFTVPKNRSLASPLQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSART

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH2D4A (F-5) : m-IgG Fc BP-HRP Bundle
sc-531054 1 Kit

SH2D4A (F-5) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Rat Postn Pre-designed siRNA Set A
SI210858A 1 Each

Rat Postn Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit anti-Sheep IgG Antibody, FITC conjugated
CSB-PA00110G1Rb 500 µg

Rabbit anti-Sheep IgG Antibody, FITC conjugated

Sign In for Pricing
View Details
Encephalitis, Eastern Equine (EEE) (Biotin)
E2280-02-Biotin 100 µL

Encephalitis, Eastern Equine (EEE) (Biotin)

Sign In for Pricing
View Details
Chenodeoxycholic acid-BSA conjugate
orb527307 1 mg

Chenodeoxycholic acid-BSA conjugate

Sign In for Pricing
View Details
WDR41 Human Gene Knockout Kit (CRISPR)
KN401693 1 Kit

WDR41 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details