Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYB Rabbit Polyclonal Antibody (FITC)

MYB Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Efg, Cmyb, c-myb, c-myb_CDS

UniProt

P10242

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MYB

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AFTVPKNRSLASPLQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSART

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBA1 Polyclonal Antibody, HRP Conjugated
A57841-050 50 µL

HBA1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Pik3r2 3'UTR Lenti-reporter-Luc Vector
36686086 1.0 µg

Pik3r2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
TAF II p135 Lentiviral Activation Particles (m)
sc-432831-LAC 200 µL

TAF II p135 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
ACTA2 Protein Lysate (Rat) with C-HA Tag
11230036 100 µg

ACTA2 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Hsa-miR-509-5p miRNA Antagomir
CIJ0613-01 10 nmol

Hsa-miR-509-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-509-5p miRNA Antagomir
CIJ0613-02 20 nmol

Hsa-miR-509-5p miRNA Antagomir

Sign In for Pricing
View Details