Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYB Rabbit Polyclonal Antibody (FITC)

MYB Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Efg, Cmyb, c-myb, c-myb_CDS

UniProt

P10242

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MYB

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AFTVPKNRSLASPLQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSART

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HE4 Matched Antibody Pair Set [ABP-S-05559]
ABP-S-05559 5 Plates

Human HE4 Matched Antibody Pair Set [ABP-S-05559]

Sign In for Pricing
View Details
PTER Peptide - N-terminal region (AAP61159)
AAP61159-100UG 100 µg

PTER Peptide - N-terminal region (AAP61159)

Sign In for Pricing
View Details
Human Monoclonal CD20 Antibody (ocaratuzumab) [Janelia Fluor 525]
NBP3-28693JF525 0.1 mL

Human Monoclonal CD20 Antibody (ocaratuzumab) [Janelia Fluor 525]

Sign In for Pricing
View Details
LYRM1 Protein Lysate
OCOA18598-20UG 20 µg

LYRM1 Protein Lysate

Sign In for Pricing
View Details
Sheep Pituitary Adenylate Cyclase Activating Peptide 38 ELISA kit
GTR10426076 96 Well

Sheep Pituitary Adenylate Cyclase Activating Peptide 38 ELISA kit

Sign In for Pricing
View Details
PFDN1 peptide
orb257037-01 1 mg

PFDN1 peptide

Sign In for Pricing
View Details