Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TP53BP2 Rabbit Polyclonal Antibody (FITC)

TP53BP2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BBP, 53BP2, ASPP2, P53BP2, PPP1R13A

UniProt

Q13625

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TP53BP2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TLAELQEMASRQQQQIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQEKL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

124kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001026855

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXJ1 (Forkhead Box Protein J1, Forkhead-related Protein FKHL13, Hepatocyte Nuclear Factor 3 Forkhead Homolog 4, HFH-4, FKHL13, HFH4) (MaxLight 490)
MBS6378862-01 0.1 mL

FOXJ1 (Forkhead Box Protein J1, Forkhead-related Protein FKHL13, Hepatocyte Nuclear Factor 3 Forkhead Homolog 4, HFH-4, FKHL13, HFH4) (MaxLight 490)

Sign In for Pricing
View Details
FOXJ1 (Forkhead Box Protein J1, Forkhead-related Protein FKHL13, Hepatocyte Nuclear Factor 3 Forkhead Homolog 4, HFH-4, FKHL13, HFH4) (MaxLight 490)
MBS6378862-02 5x 0.1 mL

FOXJ1 (Forkhead Box Protein J1, Forkhead-related Protein FKHL13, Hepatocyte Nuclear Factor 3 Forkhead Homolog 4, HFH-4, FKHL13, HFH4) (MaxLight 490)

Sign In for Pricing
View Details
Ubiquitin carboxyl-terminal hydrolase 37 (USP37) Mouse ELISA Kit
I0133 96 Tests

Ubiquitin carboxyl-terminal hydrolase 37 (USP37) Mouse ELISA Kit

Sign In for Pricing
View Details
Anti-Cystatin C/CST3 Antibody Picoband® (monoclonal, 4H8), PE Conjugate
M00961-1-PE 100 µg/Vial

Anti-Cystatin C/CST3 Antibody Picoband® (monoclonal, 4H8), PE Conjugate

Sign In for Pricing
View Details
Recombinant Aspergillus oryzae Probable alpha-L-arabinofuranosidase axhA (axhA)
MBS1383012-01 0.02 mg (E-Coli)

Recombinant Aspergillus oryzae Probable alpha-L-arabinofuranosidase axhA (axhA)

Sign In for Pricing
View Details
Recombinant Aspergillus oryzae Probable alpha-L-arabinofuranosidase axhA (axhA)
MBS1383012-02 0.02 mg (Yeast)

Recombinant Aspergillus oryzae Probable alpha-L-arabinofuranosidase axhA (axhA)

Sign In for Pricing
View Details